NSUN5P2 antibody (Middle Region)
-
- Target See all NSUN5P2 products
- NSUN5P2 (NOP2/Sun Domain Family, Member 5 Pseudogene 2 (NSUN5P2))
- Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NSUN5P2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NSUN5 C antibody was raised against the middle region of NSUN5
- Purification
- Purified
- Immunogen
- NSUN5 C antibody was raised using the middle region of NSUN5 corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NSUN5C Blocking Peptide, catalog no. 33R-6965, is also available for use as a blocking control in assays to test for specificity of this NSUN5C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NSUN5P2 (NOP2/Sun Domain Family, Member 5 Pseudogene 2 (NSUN5P2))
- Alternative Name
- NSUN5C (NSUN5P2 Products)
- Synonyms
- NOL1R2 antibody, NSUN5C antibody, WBSCR20B antibody, WBSCR20C antibody, NOP2/Sun RNA methyltransferase family member 5 pseudogene 2 antibody, NSUN5P2 antibody
- Background
- NSUN5C gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder.
- Molecular Weight
- 34 kDa (MW of target protein)
-