PPFIBP1 antibody

Catalog No. ABIN629802

Product Details anti-PPFIBP1 Antibody

Target: PPFIBP1 (PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPFIBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPFIBP1 Blocking Peptide, catalog no. 33R-7081, is also available for use as a blocking control in assays to test for specificity of this PPFIBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPFIBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPFIBP1

Target: PPFIBP1 (PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1))

Alternative Name: PPFIBP1 (PPFIBP1 Products)

Synonyms: liprin-beta-1 antibody, L2 antibody, SGT2 antibody, hSGT2 antibody, hSgt2p antibody, 4632409B19Rik antibody, AW214454 antibody, AW261454 antibody, PPFIA binding protein 1 antibody, PTPRF interacting protein, binding protein 1 (liprin beta 1) antibody, PTPRF interacting protein, binding protein 1 (liprin beta 1) S homeolog antibody, Ppfibp1 antibody, ppfibp1 antibody, ppfibp1.S antibody, PPFIBP1 antibody

Background: PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.

Molecular Weight: 19 kDa (MW of target protein)