TNNT3 antibody

Catalog No. ABIN629806

Product Details anti-TNNT3 Antibody

Target: TNNT3 (Fast Skeletal Troponin T (TNNT3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNNT3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Troponin T Type 3 Blocking Peptide, catalog no. 33R-7331, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNNT3

Target: TNNT3 (Fast Skeletal Troponin T (TNNT3))

Alternative Name: Troponin T Type 3 (TNNT3 Products)

Synonyms: fTnT antibody, tnnt3a antibody, TNTF antibody, TnTf antibody, Tnt antibody, Tnnt3 antibody, troponin T3, fast skeletal type antibody, troponin T3, skeletal, fast antibody, troponin T3, fast skeletal type S homeolog antibody, troponin T type 3 (skeletal, fast) antibody, troponin T1, slow skeletal type antibody, TNNT3 antibody, Tnnt3 antibody, tnnt3.S antibody, TNNT1 antibody

Background: Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.

Molecular Weight: 30 kDa (MW of target protein)