CUEDC1 antibody (Middle Region)

Catalog No. ABIN629850

Product Details anti-CUEDC1 Antibody

Target: CUEDC1 (CUE Domain Containing 1 (CUEDC1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CUEDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CUEDC1 antibody was raised against the middle region of CUEDC1

Purification: Purified

Immunogen: CUEDC1 antibody was raised using the middle region of CUEDC1 corresponding to a region with amino acids RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CUEDC1 Blocking Peptide, catalog no. 33R-8082, is also available for use as a blocking control in assays to test for specificity of this CUEDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUEDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CUEDC1

Target: CUEDC1 (CUE Domain Containing 1 (CUEDC1))

Alternative Name: CUEDC1 (CUEDC1 Products)

Synonyms: AI841487 antibody, C330016O16Rik antibody, RGD1304861 antibody, CUEDC1 antibody, zgc:153423 antibody, zgc:162271 antibody, CUE domain containing 1 antibody, CUE domain containing 1 L homeolog antibody, CUE domain containing 1a antibody, CUE domain containing 1b antibody, CUEDC1 antibody, Cuedc1 antibody, cuedc1.L antibody, cuedc1 antibody, cuedc1a antibody, cuedc1b antibody

Background: The function of CUE protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 42 kDa (MW of target protein)