TNNI2 antibody
-
- Target See all TNNI2 Antibodies
- TNNI2 (Fast Skeletal Troponin I (TNNI2))
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TNNI2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- Troponin I Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
- Top Product
- Discover our top product TNNI2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Troponin I Type 2 Blocking Peptide, catalog no. 33R-7190, is also available for use as a blocking control in assays to test for specificity of this Troponin I Type 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNNI2 (Fast Skeletal Troponin I (TNNI2))
- Abstract
- TNNI2 Products
- Synonyms
- AMCD2B antibody, DA2B antibody, FSSV antibody, fsTnI antibody, TnI-F4 antibody, TnI antibody, TNI antibody, hm:zehn0173 antibody, tnni2 antibody, tropI-1d antibody, zgc:86800 antibody, troponin I2, fast skeletal type antibody, troponin I type 2 (skeletal, fast) antibody, troponin I, fast skeletal muscle-like antibody, troponin I, skeletal, fast 2 antibody, troponin I type 2a (skeletal, fast), tandem duplicate 4 antibody, TNNI2 antibody, Tnni2 antibody, tnni2a.4 antibody
- Background
- Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
- Molecular Weight
- 21 kDa (MW of target protein)
-