TNNI2 antibody

Catalog No. ABIN629866

Product Details anti-TNNI2 Antibody

Target: TNNI2 (Fast Skeletal Troponin I (TNNI2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNNI2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: Troponin I Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Troponin I Type 2 Blocking Peptide, catalog no. 33R-7190, is also available for use as a blocking control in assays to test for specificity of this Troponin I Type 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNNI2

Target: TNNI2 (Fast Skeletal Troponin I (TNNI2))

Abstract: TNNI2 Products

Synonyms: AMCD2B antibody, DA2B antibody, FSSV antibody, fsTnI antibody, TnI-F4 antibody, TnI antibody, TNI antibody, hm:zehn0173 antibody, tnni2 antibody, tropI-1d antibody, zgc:86800 antibody, troponin I2, fast skeletal type antibody, troponin I type 2 (skeletal, fast) antibody, troponin I, fast skeletal muscle-like antibody, troponin I, skeletal, fast 2 antibody, troponin I type 2a (skeletal, fast), tandem duplicate 4 antibody, TNNI2 antibody, Tnni2 antibody, tnni2a.4 antibody

Background: Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.

Molecular Weight: 21 kDa (MW of target protein)