Retinoic Acid Receptor alpha antibody (N-Term)

Catalog No. ABIN629874

The Rabbit Polyclonal anti-Retinoic Acid Receptor alpha antibody (ABIN629874) specifically detects Retinoic Acid Receptor alpha in WB. The antibody is reactive with Human samples.

Quick Overview for Retinoic Acid Receptor alpha antibody (N-Term) (ABIN629874)

Target: Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Retinoic Acid Receptor alpha antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Retinoic Acid Receptor alpha Antibody

Binding Specificity: N-Term

Specificity: RARA antibody was raised against the N terminal of RARA

Purification: Purified

Immunogen: RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids TPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIETQS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RARA Blocking Peptide, (ABIN5615760), is also available for use as a blocking control in assays to test for specificity of this RARA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Retinoic Acid Receptor alpha

Target: Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))

Alternative Name: RARA

Background: RARA contains 1 nuclear receptor DNA-binding domain and belongs to the nuclear hormone receptor family, NR1 subfamily. It is a receptor for retinoic acid. This metabolite has profound effects on vertebrate development. Retinoic acid is a morphogen and is a powerful teratogen. This receptor controls cell function by directly regulating gene expression

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, S100 Proteins