Retinoic Acid Receptor alpha antibody (N-Term)
-
- Target See all Retinoic Acid Receptor alpha (RARA) Antibodies
- Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Retinoic Acid Receptor alpha antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RARA antibody was raised against the N terminal of RARA
- Purification
- Purified
- Immunogen
- RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids TPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIETQS
- Top Product
- Discover our top product RARA Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RARA Blocking Peptide, catalog no. 33R-9226, is also available for use as a blocking control in assays to test for specificity of this RARA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))
- Alternative Name
- RARA (RARA Products)
- Synonyms
- NR1B1 antibody, RAR antibody, Nr1b1 antibody, RARalpha1 antibody, rar-alpha antibody, etID309833.12 antibody, rara antibody, rara2a antibody, zRAR antibody, zRAR-alpha antibody, zgc:109797 antibody, nr1b1 antibody, RAR-ALPHA1 antibody, HS-RARa antibody, fj66e06 antibody, rara2b antibody, wu:fj66e06 antibody, retinoic acid receptor alpha antibody, retinoic acid receptor, alpha antibody, retinoic acid receptor, alpha a antibody, retinoic acid receptor alpha L homeolog antibody, retinoic acid receptor, alpha b antibody, RARA antibody, Rara antibody, LOC100136372 antibody, raraa antibody, rara.L antibody, rara antibody, rarab antibody
- Background
- RARA contains 1 nuclear receptor DNA-binding domain and belongs to the nuclear hormone receptor family, NR1 subfamily. It is a receptor for retinoic acid. This metabolite has profound effects on vertebrate development. Retinoic acid is a morphogen and is a powerful teratogen. This receptor controls cell function by directly regulating gene expression
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, S100 Proteins
-