ERI1 antibody (C-Term)

Catalog No. ABIN629880

Product Details anti-ERI1 Antibody

Target: ERI1 (Exoribonuclease 1 (ERI1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERI1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: THEX1 antibody was raised against the C terminal of theX1

Purification: Purified

Immunogen: THEX1 antibody was raised using the C terminal of theX1 corresponding to a region with amino acids GSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

THEX1 Blocking Peptide, catalog no. 33R-3597, is also available for use as a blocking control in assays to test for specificity of this THEX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THEX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERI1

Target: ERI1 (Exoribonuclease 1 (ERI1))

Alternative Name: THEX1 (ERI1 Products)

Synonyms: THEX1 antibody, thex1 antibody, zgc:110635 antibody, hexo antibody, Eri-1 antibody, 3'HEXO antibody, HEXO antibody, 3'hexo antibody, 3110010F15Rik antibody, Thex1 antibody, eri-1 antibody, RGD1308378 antibody, exoribonuclease 1 antibody, three prime repair exonuclease 1 antibody, exoribonuclease 1 L homeolog antibody, 3'-5' exonuclease eri-1 antibody, ERI1 antibody, CpipJ_CPIJ003945 antibody, eri1 antibody, eri1.L antibody, Eri1 antibody, eri-1 antibody

Background: THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi).

Molecular Weight: 38 kDa (MW of target protein)