DDX49 antibody
-
- Target See all DDX49 Antibodies
- DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DDX49 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR
- Top Product
- Discover our top product DDX49 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDX49 Blocking Peptide, catalog no. 33R-2530, is also available for use as a blocking control in assays to test for specificity of this DDX49 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX49 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))
- Alternative Name
- DDX49 (DDX49 Products)
- Synonyms
- MGC76291 antibody, r27090_2 antibody, DDX49 antibody, wu:fb82g04 antibody, wu:fd12e05 antibody, ddx49-a antibody, R27090_2 antibody, DEAD-box helicase 49 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 antibody, DEAD-box helicase 49 S homeolog antibody, ddx49 antibody, DDX49 antibody, ddx49.S antibody, Ddx49 antibody
- Background
- The function of Anti-DDX49 has not yet been determined.
- Molecular Weight
- 53 kDa (MW of target protein)
-