HNRNPD/AUF1 antibody

Catalog No. ABIN629893

Product Details anti-HNRNPD/AUF1 Antibody

Target: HNRNPD/AUF1 (HNRNPD) (Heterogeneous Nuclear Ribonucleoprotein D (HNRNPD))

Reactivity: Human, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPD/AUF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: HNRPD antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPD Blocking Peptide, catalog no. 33R-10116, is also available for use as a blocking control in assays to test for specificity of this HNRPD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPD/AUF1

Target: HNRNPD/AUF1 (HNRNPD) (Heterogeneous Nuclear Ribonucleoprotein D (HNRNPD))

Alternative Name: HNRPD (HNRNPD Products)

Synonyms: AUF1 antibody, AUF1A antibody, HNRPD antibody, P37 antibody, hnRNPD0 antibody, Auf1 antibody, Hnrnpd antibody, HNRNPD antibody, p37 antibody, auf1a antibody, hnrpd antibody, hnrnpd0 antibody, C230004L04 antibody, Hnrpd antibody, wu:fa28b06 antibody, zgc:162951 antibody, heterogeneous nuclear ribonucleoprotein D antibody, heterogeneous nuclear ribonucleoprotein D L homeolog antibody, HNRNPD antibody, Hnrnpd antibody, hnrnpd antibody, hnrnpd.L antibody

Background: HNRPD belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.

Molecular Weight: 39 kDa (MW of target protein)