TARBP2 antibody

Catalog No. ABIN629947

Product Details anti-TARBP2 Antibody

Target: TARBP2 (TAR (HIV-1) RNA Binding Protein 2 (TARBP2))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TARBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TARBP2 Blocking Peptide, catalog no. 33R-1405, is also available for use as a blocking control in assays to test for specificity of this TARBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TARBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TARBP2

Target: TARBP2 (TAR (HIV-1) RNA Binding Protein 2 (TARBP2))

Alternative Name: TARBP2 (TARBP2 Products)

Synonyms: trbp antibody, trbp1 antibody, trbp2 antibody, MGC97783 antibody, TARBP2 antibody, LOQS antibody, TRBP antibody, TRBP1 antibody, TRBP2 antibody, fj51e12 antibody, wu:fj51e12 antibody, zgc:63778 antibody, Prbp antibody, TAR (HIV-1) RNA binding protein 2 antibody, TARBP2, RISC loading complex RNA binding subunit antibody, TAR (HIV-1) RNA binding protein 2 L homeolog antibody, TAR (HIV) RNA binding protein 2 antibody, tarbp2 antibody, TARBP2 antibody, tarbp2.L antibody, Tarbp2 antibody

Background: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARBP2 binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein.

Molecular Weight: 8 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways, Ribonucleoprotein Complex Subunit Organization