PUF60 antibody (C-Term)
-
- Target See all PUF60 Antibodies
- PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PUF60 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- PUF60 antibody was raised against the C terminal of PUF60
- Purification
- Purified
- Immunogen
- PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
- Top Product
- Discover our top product PUF60 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUF60 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))
- Alternative Name
- PUF60 (PUF60 Products)
- Synonyms
- FIR antibody, RoBPI antibody, SIAHBP1 antibody, fc21a05 antibody, wu:fc21a05 antibody, wu:fi43a08 antibody, 2410104I19Rik antibody, 2810454F19Rik antibody, Siahbp1 antibody, fe37c05 antibody, repressor antibody, si:ch211-12p8.2 antibody, si:zc12p8.2 antibody, wu:fb33e11 antibody, wu:fe37c05 antibody, zgc:86806 antibody, poly(U) binding splicing factor 60 antibody, poly-U binding splicing factor a antibody, poly-U binding splicing factor 60 antibody, poly-U binding splicing factor b antibody, PUF60 antibody, puf60a antibody, Puf60 antibody, puf60b antibody
- Background
- PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.
- Molecular Weight
- 58 kDa (MW of target protein)
-