DDX41 antibody

Catalog No. ABIN630056

Product Details anti-DDX41 Antibody

Target: DDX41 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX41 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX41 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX41 Blocking Peptide, catalog no. 33R-1267, is also available for use as a blocking control in assays to test for specificity of this DDX41 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX41 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX41

Target: DDX41 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41))

Alternative Name: DDX41 (DDX41 Products)

Synonyms: DDX41 antibody, ABS antibody, 2900024F02Rik antibody, AA958953 antibody, AI324246 antibody, wu:fb92e02 antibody, zgc:55896 antibody, DEAD-box helicase 41 antibody, probable ATP-dependent RNA helicase DDX41 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 antibody, DDX41 antibody, LOC100215941 antibody, ddx41 antibody, LOC100638079 antibody, Ddx41 antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression.

Molecular Weight: 68 kDa (MW of target protein)