KCNAB2 antibody (C-Term)

Catalog No. ABIN630079

Product Details anti-KCNAB2 Antibody

Target: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Binding Specificity: C-Term

Reactivity: Rat, Human, Mouse, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNAB2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNAB2 antibody was raised against the C terminal of KCNAB2

Purification: Purified

Immunogen: KCNAB2 antibody was raised using the C terminal of KCNAB2 corresponding to a region with amino acids KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNAB2 Blocking Peptide, catalog no. 33R-4735, is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNAB2

Target: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Alternative Name: KCNAB2 (KCNAB2 Products)

Synonyms: kcnab2 antibody, KCNAB2 antibody, DKFZp459E056 antibody, akr6a5 antibody, kcna2b antibody, kvb-a antibody, kvb2 antibody, kvbeta2 antibody, kvbeta2.1 antibody, kvbeta2.2 antibody, AKR6A5 antibody, HKvbeta2 antibody, HKvbeta2.1 antibody, HKvbeta2.2 antibody, KCNA2B antibody, KV-BETA-2 antibody, Kvbeta2.1 antibody, F5 antibody, I2rf5 antibody, Kcnb3 antibody, kv-beta-2 antibody, potassium channel, voltage gated subfamily A regulatory beta subunit 1 antibody, potassium voltage-gated channel subfamily A regulatory beta subunit 2 antibody, potassium voltage-gated channel, shaker-related subfamily, beta member 2 a antibody, potassium channel, voltage gated subfamily A regulatory beta subunit 2 L homeolog antibody, voltage-gated potassium channel subunit beta-2 antibody, potassium voltage-gated channel, shaker-related subfamily, beta member 2 antibody, kcnab1 antibody, KCNAB2 antibody, kcnab2a antibody, kcnab2.L antibody, LOC397248 antibody, Kcnab2 antibody

Background: This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.

Molecular Weight: 39 kDa (MW of target protein)