CACNG4 antibody (N-Term)
-
- Target See all CACNG4 Antibodies
- CACNG4 (Calcium Channel, Voltage-Dependent, gamma Subunit 4 (CACNG4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CACNG4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CACNG4 antibody was raised against the N terminal of CACNG4
- Purification
- Purified
- Immunogen
- CACNG4 antibody was raised using the N terminal of CACNG4 corresponding to a region with amino acids GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL
- Top Product
- Discover our top product CACNG4 Primary Antibody
-
-
- Application Notes
-
WB: 0.31 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CACNG4 Blocking Peptide, catalog no. 33R-3480, is also available for use as a blocking control in assays to test for specificity of this CACNG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNG4 (Calcium Channel, Voltage-Dependent, gamma Subunit 4 (CACNG4))
- Alternative Name
- CACNG4 (CACNG4 Products)
- Synonyms
- CACNG4 antibody, AI413107 antibody, AW491861 antibody, calcium voltage-gated channel auxiliary subunit gamma 4 antibody, calcium channel, voltage-dependent, gamma subunit 4 antibody, CACNG4 antibody, Cacng4 antibody
- Background
- L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits.
- Molecular Weight
- 36 kDa (MW of target protein)
-