VDAC1 antibody (C-Term)
-
- Target See all VDAC1 Antibodies
- VDAC1 (Voltage-Dependent Anion Channel 1 (VDAC1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VDAC1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- VDAC1 antibody was raised against the C terminal of VDAC1
- Purification
- Purified
- Immunogen
- VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
- Top Product
- Discover our top product VDAC1 Primary Antibody
-
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (AA 1-30), (N-Term) antibody
VDAC1 Reactivity: Human, Mouse WB, IHC (p), FACS Host: Rabbit Polyclonal RB19920 unconjugated
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (AA 1-283) antibodyVDAC1 Reactivity: Human WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (AA 95-124) antibodyVDAC1 Reactivity: Human WB, IHC (p), FACS Host: Rabbit Polyclonal RB19925 unconjugated
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (AA 1-283) antibodyVDAC1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S152B-23 unconjugated
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (AA 1-283) antibody (HRP)VDAC1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S152B-23 HRP
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (N-Term) antibody (HRP)VDAC1 Reactivity: Human WB, IHC, ICC, IF Host: Rabbit Polyclonal HRP
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (AA 1-283) antibody (FITC)VDAC1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S152B-23 FITC
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (N-Term) antibody (Alkaline Phosphatase (AP))VDAC1 Reactivity: Human WB, IHC, ICC, IF Host: Rabbit Polyclonal Alkaline Phosphatase (AP)
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (AA 1-283) antibody (Biotin)VDAC1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S152B-23 Biotin
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (AA 1-283) antibody (PE)VDAC1 Reactivity: Human WB, IHC, ICC, IF Host: Mouse Monoclonal S152B-23 PE
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VDAC1 Blocking Peptide, catalog no. 33R-8303, is also available for use as a blocking control in assays to test for specificity of this VDAC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VDAC1 (Voltage-Dependent Anion Channel 1 (VDAC1))
- Alternative Name
- VDAC1 (VDAC1 Products)
- Synonyms
- vdac1 antibody, VDAC1 antibody, 5076 antibody, ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1 antibody, ATVDAC1 antibody, T22N4.9 antibody, T22N4_9 antibody, voltage dependent anion channel 1 antibody, PORIN antibody, VDAC-1 antibody, AL033343 antibody, Vdac5 antibody, fa13f11 antibody, wu:fa13f11 antibody, zgc:85830 antibody, voltage-dependent anion channel 1 S homeolog antibody, voltage-dependent anion channel 1 antibody, voltage dependent anion channel 1 antibody, vdac1.S antibody, vdac1 antibody, VDAC1 antibody, Vdac1 antibody
- Background
- The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.
- Molecular Weight
- 31 kDa (MW of target protein)
-
