FZD9 antibody
-
- Target See all FZD9 Antibodies
- FZD9 (Frizzled Family Receptor 9 (FZD9))
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FZD9 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
- Top Product
- Discover our top product FZD9 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FZD9 Blocking Peptide, catalog no. 33R-8100, is also available for use as a blocking control in assays to test for specificity of this FZD9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FZD9 (Frizzled Family Receptor 9 (FZD9))
- Alternative Name
- FZD9 (FZD9 Products)
- Synonyms
- CD349 antibody, FZD3 antibody, mfz9 antibody, Fz-9 antibody, cFz-9 antibody, fz11 antibody, fzd9 antibody, fzx antibody, hm:zehl0603 antibody, zehl0603 antibody, zg11 antibody, frizzled class receptor 9 antibody, frizzled class receptor 9a antibody, frizzled class receptor 9b antibody, FZD9 antibody, Fzd9 antibody, fzd9a antibody, fzd9b antibody
- Background
- FZD9 contains 1 FZ (frizzled) domain and belongs to the G-protein coupled receptor Fz/Smo family. It is receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- WNT Signaling
-