MMP7 antibody

Catalog No. ABIN630130

Product Details anti-MMP7 Antibody

Target: MMP7 (Matrix Metallopeptidase 7 (Matrilysin, Uterine) (MMP7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP7 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: MMP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP7 Blocking Peptide, catalog no. 33R-1053, is also available for use as a blocking control in assays to test for specificity of this MMP7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP7

Target: MMP7 (Matrix Metallopeptidase 7 (Matrilysin, Uterine) (MMP7))

Alternative Name: MMP7 (MMP7 Products)

Synonyms: MAT antibody, MPMM antibody, MMP-7 antibody, MPSL1 antibody, PUMP-1 antibody, matrilysin antibody, LOC727698 antibody, MMP7 antibody, Matrilysin antibody, matrix metallopeptidase 7 antibody, MMP7 antibody, Mmp7 antibody

Background: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP7 degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa.

Molecular Weight: 19 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response