Olfactomedin 4 antibody (C-Term)

Catalog No. ABIN630153

Product Details anti-Olfactomedin 4 Antibody

Target: Olfactomedin 4 (OLFM4)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Olfactomedin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OLFM4 antibody was raised against the C terminal of OLFM4

Purification: Purified

Immunogen: OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OLFM4 Blocking Peptide, catalog no. 33R-2362, is also available for use as a blocking control in assays to test for specificity of this OLFM4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Olfactomedin 4

Target: Olfactomedin 4 (OLFM4)

Alternative Name: OLFM4 (OLFM4 Products)

Synonyms: tiarin antibody, GC1 antibody, GW112 antibody, OLM4 antibody, OlfD antibody, UNQ362 antibody, bA209J19.1 antibody, hGC-1 antibody, hOLfD antibody, Gm296 antibody, Gm913 antibody, pPD4 antibody, olfactomedin-4 antibody, olfactomedin 4 L homeolog antibody, olfactomedin 4 antibody, olfactomedin-4-like antibody, olfm4.L antibody, OLFM4 antibody, olfm4 antibody, LOC100225360 antibody, Olfm4 antibody

Background: OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.

Molecular Weight: 55 kDa (MW of target protein)