Renin antibody (C-Term)
-
- Target See all Renin (REN) Antibodies
- Renin (REN)
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Renin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Renin antibody was raised against the C terminal of REN
- Purification
- Purified
- Immunogen
- Renin antibody was raised using the C terminal of REN corresponding to a region with amino acids YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA
- Top Product
- Discover our top product REN Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Renin Blocking Peptide, catalog no. 33R-10250, is also available for use as a blocking control in assays to test for specificity of this Renin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Renin (REN)
- Alternative Name
- Renin (REN Products)
- Synonyms
- HNFJ2 antibody, RATRENAA antibody, RENAA antibody, Ren1 antibody, D19352 antibody, Ren antibody, Ren-1 antibody, Ren-A antibody, Ren1c antibody, Ren1d antibody, Rn-1 antibody, Rnr antibody, renin antibody, renin 1 structural antibody, REN antibody, Ren antibody, Ren1 antibody, ren antibody
- Background
- Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour
-