Cullin 5 antibody (C-Term)

Catalog No. ABIN630202

Product Details anti-Cullin 5 Antibody

Target: Cullin 5 (CUL5)

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cullin 5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cullin 5 antibody was raised against the C terminal of CUL5

Purification: Purified

Immunogen: Cullin 5 antibody was raised using the C terminal of CUL5 corresponding to a region with amino acids VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cullin 5 Blocking Peptide, catalog no. 33R-9706, is also available for use as a blocking control in assays to test for specificity of this Cullin 5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cullin 5

Target: Cullin 5 (CUL5)

Alternative Name: Cullin 5 (CUL5 Products)

Synonyms: cul5 antibody, wu:fd17d09 antibody, wu:fi20h12 antibody, xx:11fd17d09 antibody, zgc:66185 antibody, Xcullin5 antibody, CG1401 antibody, CUL5 antibody, Cul5 antibody, Cullin 5 antibody, Cullin5 antibody, Dmel\\CG1401 antibody, cul-5 antibody, vacm-1 antibody, vacm1 antibody, VACM-1 antibody, VACM1 antibody, 4921514I20Rik antibody, 8430423K24Rik antibody, AI852817 antibody, C030032G03Rik antibody, C330021I08Rik antibody, Cullin-5 antibody, cullin 5a antibody, cullin 5 L homeolog antibody, Cullin 5 antibody, cullin 5 antibody, Cullin-5 antibody, cul5a antibody, cul5.L antibody, Cul5 antibody, CUL5 antibody, cul5 antibody, cul-5 antibody

Background: CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.

Molecular Weight: 86 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development