Annexin V antibody (N-Term)
-
- Target See all Annexin V (ANXA5) Antibodies
- Annexin V (ANXA5) (Annexin A5 (ANXA5))
-
Binding Specificity
- N-Term
-
Reactivity
- Chemical
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Annexin V antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Annexin A5 antibody was raised against the N terminal of ANXA5
- Cross-Reactivity
- Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
- Purification
- Purified
- Immunogen
- Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
- Top Product
- Discover our top product ANXA5 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Annexin A5 Blocking Peptide, catalog no. 33R-8393, is also available for use as a blocking control in assays to test for specificity of this Annexin A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin V (ANXA5) (Annexin A5 (ANXA5))
- Alternative Name
- Annexin A5 (ANXA5 Products)
- Synonyms
- anx antibody, anx5 antibody, ANX V antibody, anxa5 antibody, cb989 antibody, wu:fa98f06 antibody, wu:fj10f10 antibody, MGC89158 antibody, ANX5 antibody, ENX2 antibody, PP4 antibody, RPRGL3 antibody, Anx5 antibody, R74653 antibody, LC5 antibody, enx2 antibody, annexin A5 antibody, annexin A5b antibody, Annexin A5 antibody, annexin A5 L homeolog antibody, ANXA5 antibody, anxa5b antibody, anxa5 antibody, Anxa5 antibody, anxa5.L antibody
- Target Type
- Chemical
- Background
- The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Apoptosis
-