ANXA6 antibody (N-Term)

Catalog No. ABIN630246

Product Details anti-ANXA6 Antibody

Target: ANXA6 (Annexin A6 (ANXA6))

Binding Specificity: N-Term

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANXA6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Annexin A6 antibody was raised against the N terminal of ANXA6

Cross-Reactivity: Human

Purification: Purified

Immunogen: Annexin A6 antibody was raised using the N terminal of ANXA6 corresponding to a region with amino acids ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYE

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A6 Blocking Peptide, catalog no. 33R-1381, is also available for use as a blocking control in assays to test for specificity of this Annexin A6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANXA6

Target: ANXA6 (Annexin A6 (ANXA6))

Alternative Name: Annexin A6 (ANXA6 Products)

Synonyms: ANX6 antibody, CBP68 antibody, AW107198 antibody, Anx6 antibody, AnxVI antibody, Cabm antibody, Camb antibody, CPB-II antibody, anx6 antibody, cbp68 antibody, ANXA6 antibody, DKFZp459M247 antibody, anxa6 antibody, annexin A6 antibody, annexin A6 L homeolog antibody, ANXA6 antibody, Anxa6 antibody, anxa6 antibody, anxa6.L antibody

Target Type: Chemical

Background: Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.

Molecular Weight: 74 kDa (MW of target protein)