Annexin VII antibody (N-Term)

Catalog No. ABIN630253

Product Details anti-Annexin VII Antibody

Target: Annexin VII (ANXA7) (Annexin A7 (ANXA7))

Binding Specificity: N-Term

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin VII antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Annexin A7 antibody was raised against the N terminal of ANXA7

Cross-Reactivity: Human

Purification: Purified

Immunogen: Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A7 Blocking Peptide, catalog no. 33R-3296, is also available for use as a blocking control in assays to test for specificity of this Annexin A7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Annexin VII

Target: Annexin VII (ANXA7) (Annexin A7 (ANXA7))

Alternative Name: Annexin A7 (ANXA7 Products)

Synonyms: ANX7 antibody, SNX antibody, SYNEXIN antibody, AI265384 antibody, AI316497 antibody, Anx7 antibody, synexin antibody, anxa7 antibody, MGC76267 antibody, MGC82023 antibody, ANXA7 antibody, MGC83033 antibody, annexin A7 antibody, annexin VII antibody, annexin A7 S homeolog antibody, ANXA7 antibody, Anxa7 antibody, anxa7 antibody, anxa7.S antibody, PTRG_02166 antibody, BRAFLDRAFT_231082 antibody, PAAG_00136 antibody, MCYG_04180 antibody, VDBG_06328 antibody, MGYG_02426 antibody

Target Type: Chemical

Background: Annexin A7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin A7 gene contains 14 exons and spans approximately 34 kb of DNA. Structural analysis of the protein suggests that Annexin A7 is a membrane binding protein with diverse properties including voltage-sensitive calcium channel activity, ion selectivity and membrane fusion.

Molecular Weight: 51 kDa (MW of target protein)