NEDD9 antibody (Middle Region)
-
- Target See all NEDD9 Antibodies
- NEDD9 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 9 (NEDD9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NEDD9 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- NEDD9 antibody was raised against the middle region of NEDD9
- Purification
- Purified
- Immunogen
- NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
- Top Product
- Discover our top product NEDD9 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NEDD9 Blocking Peptide, catalog no. 33R-3816, is also available for use as a blocking control in assays to test for specificity of this NEDD9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NEDD9 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 9 (NEDD9))
- Alternative Name
- NEDD9 (NEDD9 Products)
- Synonyms
- NEDD9 antibody, CAS-L antibody, CAS2 antibody, CASL antibody, CASS2 antibody, HEF1 antibody, Cas-L antibody, CasL antibody, E230025G09Rik antibody, neural precursor cell expressed, developmentally down-regulated 9 antibody, neural precursor cell expressed, developmentally down-regulated gene 9 antibody, NEDD9 antibody, Nedd9 antibody
- Background
- Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers.
- Molecular Weight
- 93 kDa (MW of target protein)
-