NOV antibody (Middle Region)
-
- Target See all NOV Antibodies
- NOV (Nephroblastoma Overexpressed (NOV))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NOV antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NOV antibody was raised against the middle region of NOV
- Purification
- Purified
- Immunogen
- NOV antibody was raised using the middle region of NOV corresponding to a region with amino acids RNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKN
- Top Product
- Discover our top product NOV Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NOV Blocking Peptide, catalog no. 33R-8084, is also available for use as a blocking control in assays to test for specificity of this NOV antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOV antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOV (Nephroblastoma Overexpressed (NOV))
- Alternative Name
- NOV (NOV Products)
- Synonyms
- CCN3 antibody, IBP-9 antibody, IGFBP-9 antibody, IGFBP9 antibody, NOVh antibody, nov-A antibody, xnov antibody, NovH antibody, C130088N23Rik antibody, nephroblastoma overexpressed antibody, nephroblastoma overexpressed L homeolog antibody, nephroblastoma overexpressed gene antibody, NOV antibody, nov.L antibody, Nov antibody
- Background
- As an immediate-early protein, NOV is likely to play a role in cell growth regulation.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration, Growth Factor Binding
-