RARRES3 antibody
-
- Target See all RARRES3 Antibodies
- RARRES3 (Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3))
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RARRES3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- RARRES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV
- Top Product
- Discover our top product RARRES3 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RARRES3 Blocking Peptide, catalog no. 33R-3082, is also available for use as a blocking control in assays to test for specificity of this RARRES3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARRES3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RARRES3 (Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3))
- Alternative Name
- RARRES3 (RARRES3 Products)
- Synonyms
- HRASLS4 antibody, HRSL4 antibody, PLA1/2-3 antibody, RIG1 antibody, TIG3 antibody, MGC68773 antibody, RARRES3 antibody, retinoic acid receptor responder 3 antibody, retinoic acid receptor responder (tazarotene induced) 3 L homeolog antibody, zgc:92249 antibody, RARRES3 antibody, rarres3.L antibody, zgc:92249 antibody
- Background
- Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES3 is thought act as a tumor suppressor or growth regulator.
- Molecular Weight
- 18 kDa (MW of target protein)
-