SLC22A1 antibody
-
- Target See all SLC22A1 Antibodies
- SLC22A1 (Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SLC22 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
- Top Product
- Discover our top product SLC22A1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A1 Blocking Peptide, catalog no. 33R-5413, is also available for use as a blocking control in assays to test for specificity of this SLC22A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A1 (Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1))
- Alternative Name
- SLC22A1 (SLC22A1 Products)
- Synonyms
- SLC22A1 antibody, OCT1 antibody, HOCT1 antibody, oct1_cds antibody, Lx1 antibody, Oct1 antibody, Orct antibody, Orct1 antibody, Roct1 antibody, SLC22A2 antibody, solute carrier family 22 member 1 antibody, solute carrier family 22 (organic cation transporter), member 1 antibody, solute carrier family 22 member 2-like antibody, SLC22A1 antibody, Slc22a1 antibody, LOC421584 antibody
- Background
- Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A1 contains twelve putative transmembrane domains and is a plasma integral membrane protein.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Hormone Transport
-