NSDHL antibody
-
- Target See all NSDHL Antibodies
- NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NSDHL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- NSDHL antibody was raised using a synthetic peptide corresponding to a region with amino acids RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN
- Top Product
- Discover our top product NSDHL Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NSDHL Blocking Peptide, catalog no. 33R-7828, is also available for use as a blocking control in assays to test for specificity of this NSDHL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSDHL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))
- Alternative Name
- NSDHL (NSDHL Products)
- Synonyms
- zgc:112474 antibody, H105E3 antibody, SDR31E1 antibody, XAP104 antibody, AI747449 antibody, Bpa antibody, Str antibody, NAD(P) dependent steroid dehydrogenase-like antibody, NAD(P) dependent steroid dehydrogenase-like L homeolog antibody, NSDHL antibody, nsdhl antibody, nsdhl.L antibody, Nsdhl antibody
- Background
- NSDHL is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in NSDHL gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males.
- Molecular Weight
- 42 kDa (MW of target protein)
-