SLC7A14 antibody
-
- Target See all SLC7A14 products
- SLC7A14 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 14 (SLC7A14))
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC7A14 antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Purification
- Purified
- Immunogen
- SLC7 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC7A14 Blocking Peptide, catalog no. 33R-9413, is also available for use as a blocking control in assays to test for specificity of this SLC7A14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A14 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 14 (SLC7A14))
- Alternative Name
- SLC7A14 (SLC7A14 Products)
- Synonyms
- SLC7A14 antibody, A930013N06 antibody, BC061928 antibody, solute carrier family 7 member 14 antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 14 antibody, solute carrier family 7, member 14 antibody, SLC7A14 antibody, Slc7a14 antibody
- Background
- SLC7A14 possesses amino acid transmembrane transporter activity.
- Molecular Weight
- 85 kDa (MW of target protein)
-