KCNC1 antibody (N-Term)
-
- Target See all KCNC1 Antibodies
- KCNC1 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 1 (KCNC1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNC1 antibody was raised against the N terminal of KCNC1
- Purification
- Purified
- Immunogen
- KCNC1 antibody was raised using the N terminal of KCNC1 corresponding to a region with amino acids TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY
- Top Product
- Discover our top product KCNC1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNC1 Blocking Peptide, catalog no. 33R-9400, is also available for use as a blocking control in assays to test for specificity of this KCNC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNC1 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 1 (KCNC1))
- Alternative Name
- KCNC1 (KCNC1 Products)
- Synonyms
- kv3.1 antibody, C230009H10Rik antibody, KShIIIB antibody, KV4 antibody, Kcr2-1 antibody, Kv3.1 antibody, NGK2 antibody, Shaw antibody, Kv4 antibody, NGK2-KV4 antibody, KV3.1 antibody, KCNC2 antibody, zgc:194940 antibody, zgc:194950 antibody, potassium voltage-gated channel subfamily C member 1 antibody, potassium voltage-gated channel, Shaw-related subfamily, member 1 antibody, potassium voltage gated channel, Shaw-related subfamily, member 1 antibody, potassium voltage-gated channel, Shaw-related subfamily, member 1a antibody, KCNC1 antibody, kcnc1 antibody, Kcnc1 antibody, kcnc1a antibody
- Background
- KCNC1 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.
- Molecular Weight
- 58 kDa (MW of target protein)
-