KCNC1 antibody (N-Term)

Catalog No. ABIN630383

Product Details anti-KCNC1 Antibody

Target: KCNC1 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 1 (KCNC1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNC1 antibody was raised against the N terminal of KCNC1

Purification: Purified

Immunogen: KCNC1 antibody was raised using the N terminal of KCNC1 corresponding to a region with amino acids TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNC1 Blocking Peptide, catalog no. 33R-9400, is also available for use as a blocking control in assays to test for specificity of this KCNC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNC1

Target: KCNC1 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 1 (KCNC1))

Alternative Name: KCNC1 (KCNC1 Products)

Synonyms: kv3.1 antibody, C230009H10Rik antibody, KShIIIB antibody, KV4 antibody, Kcr2-1 antibody, Kv3.1 antibody, NGK2 antibody, Shaw antibody, Kv4 antibody, NGK2-KV4 antibody, KV3.1 antibody, KCNC2 antibody, zgc:194940 antibody, zgc:194950 antibody, potassium voltage-gated channel subfamily C member 1 antibody, potassium voltage-gated channel, Shaw-related subfamily, member 1 antibody, potassium voltage gated channel, Shaw-related subfamily, member 1 antibody, potassium voltage-gated channel, Shaw-related subfamily, member 1a antibody, KCNC1 antibody, kcnc1 antibody, Kcnc1 antibody, kcnc1a antibody

Background: KCNC1 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Molecular Weight: 58 kDa (MW of target protein)