ZDHHC17 antibody (Middle Region)
-
- Target See all ZDHHC17 Antibodies
- ZDHHC17 (Zinc Finger, DHHC-Type Containing 17 (ZDHHC17))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZDHHC17 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZDHHC17 antibody was raised against the middle region of ZDHHC17
- Purification
- Purified
- Immunogen
- ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
- Top Product
- Discover our top product ZDHHC17 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZDHHC17 Blocking Peptide, catalog no. 33R-2993, is also available for use as a blocking control in assays to test for specificity of this ZDHHC17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC17 (Zinc Finger, DHHC-Type Containing 17 (ZDHHC17))
- Alternative Name
- ZDHHC17 (ZDHHC17 Products)
- Synonyms
- A230053P19Rik antibody, BB187739 antibody, D130071N24Rik antibody, Hip14 antibody, HIP14 antibody, HIP3 antibody, HYPH antibody, si:ch211-81a6.1 antibody, zinc finger DHHC-type containing 17 antibody, zinc finger, DHHC domain containing 17 antibody, zinc finger, DHHC-type containing 17 antibody, ZDHHC17 antibody, zdhhc17 antibody, Zdhhc17 antibody
- Background
- ZDHHC17 is a palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HD. It may be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. It may be involved in the NF-kappa-B signaling pathway and has transforming activity.
- Molecular Weight
- 44 kDa (MW of target protein)
-