FNDC3B antibody (N-Term)
-
- Target See all FNDC3B Antibodies
- FNDC3B (Fibronectin Type III Domain Containing 3B (FNDC3B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FNDC3B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FNDC3 B antibody was raised against the N terminal of FNDC3
- Purification
- Purified
- Immunogen
- FNDC3 B antibody was raised using the N terminal of FNDC3 corresponding to a region with amino acids RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP
- Top Product
- Discover our top product FNDC3B Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FNDC3B Blocking Peptide, catalog no. 33R-7822, is also available for use as a blocking control in assays to test for specificity of this FNDC3B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNDC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FNDC3B (Fibronectin Type III Domain Containing 3B (FNDC3B))
- Alternative Name
- FNDC3B (FNDC3B Products)
- Synonyms
- FAD104 antibody, PRO4979 antibody, YVTM2421 antibody, 1600019O04Rik antibody, AW550168 antibody, Fad104 antibody, mKIAA4164 antibody, RGD1311673 antibody, FNDC3B antibody, DKFZp469D136 antibody, fibronectin type III domain containing 3B antibody, FNDC3B antibody, Fndc3b antibody, fndc3b antibody
- Background
- FNDC3B may be a positive regulator of adipogenesis.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Positive Regulation of fat Cell Differentiation
-