PTPN2 antibody (N-Term)

Catalog No. ABIN630412

Product Details anti-PTPN2 Antibody

Target: PTPN2 (Protein tyrosine Phosphatase, Non-Receptor Type 2 (PTPN2))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTPN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTPN2 antibody was raised against the N terminal of PTPN2

Purification: Purified

Immunogen: PTPN2 antibody was raised using the N terminal of PTPN2 corresponding to a region with amino acids LEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINAS

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTPN2 Blocking Peptide, catalog no. 33R-4905, is also available for use as a blocking control in assays to test for specificity of this PTPN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTPN2

Target: PTPN2 (Protein tyrosine Phosphatase, Non-Receptor Type 2 (PTPN2))

Alternative Name: PTPN2 (PTPN2 Products)

Synonyms: PTN2 antibody, PTPT antibody, TC-PTP antibody, TCELLPTP antibody, TCPTP antibody, AI325124 antibody, Ptpt antibody, PTP-1B antibody, cb806 antibody, ptpn2 antibody, ptpn2l antibody, wu:fc10h07 antibody, zgc:55339 antibody, zgc:76973 antibody, hm:zeh1546 antibody, zgc:63623 antibody, ptn2 antibody, ptpt antibody, tc-ptp antibody, tcellptp antibody, tcptp antibody, protein tyrosine phosphatase, non-receptor type 2 antibody, protein tyrosine phosphatase, non-receptor type 2 S homeolog antibody, protein tyrosine phosphatase, non-receptor type 2, b antibody, protein tyrosine phosphatase, non-receptor type 2, a antibody, protein tyrosine phosphatase, non-receptor type 2 L homeolog antibody, PTPN2 antibody, Ptpn2 antibody, ptpn2.S antibody, ptpn2b antibody, ptpn2a antibody, ptpn2.L antibody

Background: PTPN2 is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Epidermal growth factor receptor and the adaptor protein Shc were reported to be substrates of this PTP, which suggested the roles in growth factor mediated cell signaling.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Platelet-derived growth Factor Receptor Signaling