Aspartate beta Hydroxylase antibody (N-Term)

Catalog No. ABIN630417

Product Details anti-Aspartate beta Hydroxylase Antibody

Target: Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Aspartate beta Hydroxylase antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ASPH antibody was raised against the N terminal of ASPH

Purification: Purified

Immunogen: ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASPH Blocking Peptide, catalog no. 33R-8411, is also available for use as a blocking control in assays to test for specificity of this ASPH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Aspartate beta Hydroxylase

Target: Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))

Alternative Name: ASPH (ASPH Products)

Synonyms: AAH antibody, BAH antibody, CASQ2BP1 antibody, HAAH antibody, JCTN antibody, junctin antibody, 2310005F16Rik antibody, 3110001L23Rik antibody, AI848629 antibody, AW261690 antibody, AW561901 antibody, C79816 antibody, cI-37 antibody, aah antibody, bah antibody, jctn antibody, MGC107896 antibody, cb971 antibody, fb69e10 antibody, fc06d04 antibody, fc95a08 antibody, wu:fb69e10 antibody, wu:fc06d04 antibody, wu:fc95a08 antibody, aspartate beta-hydroxylase antibody, aspartate-beta-hydroxylase antibody, aspartate beta-hydroxylase L homeolog antibody, ASPH antibody, Asph antibody, asph antibody, asph.L antibody

Background: ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity