CYP2A13 antibody (C-Term)
-
- Target See all CYP2A13 Antibodies
- CYP2A13 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 13 (CYP2A13))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP2A13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP2 A13 antibody was raised against the C terminal of CYP2 13
- Purification
- Purified
- Immunogen
- CYP2 A13 antibody was raised using the C terminal of CYP2 13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
- Top Product
- Discover our top product CYP2A13 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP2A13 Blocking Peptide, catalog no. 33R-2112, is also available for use as a blocking control in assays to test for specificity of this CYP2A13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP2A13 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 13 (CYP2A13))
- Alternative Name
- CYP2A13 (CYP2A13 Products)
- Synonyms
- CPAD antibody, CYP2A antibody, CYPIIA13 antibody, MGC86391 antibody, MGC88881 antibody, CYP2A13 antibody, CYP2A6 antibody, cytochrome P450 family 2 subfamily A member 13 antibody, cytochrome P450, family 2, subfamily A, polypeptide 13 antibody, cytochrome P450 family 2 subfamily A member 13 L homeolog antibody, cytochrome P450 family 2 subfamily A polypeptide 13 antibody, cytochrome P450 2A13 antibody, CYP2A13 antibody, cyp2a13.L antibody, cyp2a13 antibody, LOC540707 antibody
- Background
- CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco.
- Molecular Weight
- 54 kDa (MW of target protein)
-