RHAG antibody (Middle Region)
-
- Target See all RHAG Antibodies
- RHAG (Rh Family A Glycoprotein (RHAG))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RHAG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RHAG antibody was raised against the middle region of RHAG
- Purification
- Purified
- Immunogen
- RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
- Top Product
- Discover our top product RHAG Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RHAG Blocking Peptide, catalog no. 33R-2899, is also available for use as a blocking control in assays to test for specificity of this RHAG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHAG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHAG (Rh Family A Glycoprotein (RHAG))
- Alternative Name
- RHAG (RHAG Products)
- Synonyms
- CD241 antibody, RH2 antibody, RH50A antibody, Rh50 antibody, Rh50GP antibody, SLC42A1 antibody, Rh50A antibody, Rh-associated glycoprotein antibody, Rh associated glycoprotein antibody, Rhesus blood group-associated A glycoprotein antibody, RHAG antibody, Rhag antibody
- Background
- The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kDa, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kDa, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.
- Molecular Weight
- 45 kDa (MW of target protein)
-