NR2F6 antibody (N-Term)
-
- Target See all NR2F6 Antibodies
- NR2F6 (Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR2F6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NR2 F6 antibody was raised against the N terminal of NR2 6
- Purification
- Affinity purified
- Immunogen
- NR2 F6 antibody was raised using the N terminal of NR2 6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
- Top Product
- Discover our top product NR2F6 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR2F6 Blocking Peptide, catalog no. 33R-1199, is also available for use as a blocking control in assays to test for specificity of this NR2F6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR2F6 (Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6))
- Alternative Name
- NR2F6 (NR2F6 Products)
- Synonyms
- EAR-2 antibody, EAR2 antibody, ERBAL2 antibody, AV090102 antibody, COUP-TF3 antibody, Erbal2 antibody, COUP(II) antibody, NR2F6 antibody, couptf2 antibody, fc94g11 antibody, wu:fc94g11 antibody, zgc:77259 antibody, ear-2 antibody, ear2 antibody, erbal2 antibody, nr2f6l antibody, wu:fc72d04 antibody, zgc:77260 antibody, nuclear receptor subfamily 2 group F member 6 antibody, nuclear receptor subfamily 2, group F, member 6 antibody, nuclear receptor subfamily 2, group F, member 6a antibody, nuclear receptor subfamily 2 group F member 6 L homeolog antibody, nuclear receptor subfamily 2, group F, member 6b antibody, NR2F6 antibody, Nr2f6 antibody, nr2f6a antibody, nr2f6.L antibody, nr2f6 antibody, nr2f6b antibody
- Background
- Orphan nuclear receptor EAR-2 (NR2F6, V-erbA related protein EAR-2 ) is predicted to be a protein similar in primary structure to receptors for steroid hormones or thyroid hormone (T3).
- Molecular Weight
- 43 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Photoperiodism
-