Vitamin D Receptor antibody (N-Term)

Catalog No. ABIN630503

Product Details anti-Vitamin D Receptor Antibody

Target: Vitamin D Receptor (VDR)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Vitamin D Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VDR antibody was raised against the N terminal of VDR

Purification: Affinity purified

Immunogen: VDR antibody was raised using the N terminal of VDR corresponding to a region with amino acids ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VDR Blocking Peptide, catalog no. 33R-4052, is also available for use as a blocking control in assays to test for specificity of this VDR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Vitamin D Receptor

Target: Vitamin D Receptor (VDR)

Alternative Name: VDR (VDR Products)

Synonyms: vdrbeta antibody, vdr0 antibody, LOC100136219 antibody, NR1I1-B antibody, gb:dq017633 antibody, vdr-b antibody, Ci-VDR-b antibody, VDR antibody, LOC100221284 antibody, vdr-A antibody, xVDR antibody, Nr1i1 antibody, vdr antibody, NR1I1 antibody, PPP1R163 antibody, vitamin D (1,25- dihydroxyvitamin D3) receptor antibody, vitamin D receptor antibody, vitamin D3 receptor A antibody, vitamin D receptor b antibody, nuclear receptor VDR-b antibody, vitamin D (1,25- dihydroxyvitamin D3) receptor L homeolog antibody, vitamin D (1,25-dihydroxyvitamin D3) receptor antibody, vitamin D receptor a antibody, vdr antibody, vdr0 antibody, VDR antibody, LOC100136219 antibody, vdrb antibody, vdr-b antibody, vdr.L antibody, Vdr antibody, vdra antibody

Target Type: Chemical

Background: VDR is the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarit

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway