NR4A1 antibody (Middle Region)

Catalog No. ABIN630504

Product Details anti-NR4A1 Antibody

Target: NR4A1 (Nuclear Receptor Subfamily 4, Group A, Member 1 (NR4A1))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR4A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NR4 A1 antibody was raised against the middle region of NR4 1

Purification: Affinity purified

Immunogen: NR4 A1 antibody was raised using the middle region of NR4 1 corresponding to a region with amino acids FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR4A1 Blocking Peptide, catalog no. 33R-3032, is also available for use as a blocking control in assays to test for specificity of this NR4A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR4A1

Target: NR4A1 (Nuclear Receptor Subfamily 4, Group A, Member 1 (NR4A1))

Alternative Name: NR4A1 (NR4A1 Products)

Synonyms: GFRP1 antibody, HMR antibody, N10 antibody, NAK-1 antibody, NGFIB antibody, NP10 antibody, NUR77 antibody, TR3 antibody, NGFI-B antibody, Gfrp antibody, Hbr-1 antibody, Hbr1 antibody, Hmr antibody, TIS1 antibody, nur77 antibody, Ngfi-b antibody, Nur77 antibody, nuclear receptor subfamily 4 group A member 1 antibody, nuclear receptor subfamily 4, group A, member 1 antibody, NR4A1 antibody, Nr4a1 antibody

Background: NR4A1 encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Steroid Hormone Mediated Signaling Pathway