Retinoid X Receptor alpha antibody (N-Term)
-
- Target See all Retinoid X Receptor alpha (RXRA) Antibodies
- Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Retinoid X Receptor alpha antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RXRA antibody was raised against the N terminal of RXRA
- Purification
- Affinity purified
- Immunogen
- RXRA antibody was raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
- Top Product
- Discover our top product RXRA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RXRA Blocking Peptide, catalog no. 33R-2195, is also available for use as a blocking control in assays to test for specificity of this RXRA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))
- Alternative Name
- RXRA (RXRA Products)
- Synonyms
- NR2B1 antibody, 9530071D11Rik antibody, Nr2b1 antibody, RXRalpha1 antibody, RXRalpha antibody, rxra-A antibody, xRXR alpha antibody, xrxra antibody, RXRA antibody, RXR alpha antibody, etID309731.5 antibody, rxr antibody, rxra antibody, rxrg antibody, RXRalpha-B antibody, retinoid X receptor alpha antibody, retinoid X receptor alpha L homeolog antibody, retinoid x receptor, alpha b antibody, retinoid X receptor, alpha a antibody, RXRA antibody, Rxra antibody, rxra.L antibody, CpipJ_CPIJ010249 antibody, rxrab antibody, rxraa antibody
- Background
- Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha, Hepatitis C
-