ESRRG antibody (N-Term)

Catalog No. ABIN630513

Product Details anti-ESRRG Antibody

Target: ESRRG (Estrogen-Related Receptor gamma (ESRRG))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ESRRG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ESRRG antibody was raised against the N terminal of ESRRG

Purification: Affinity purified

Immunogen: ESRRG antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ESRRG Blocking Peptide, catalog no. 33R-2143, is also available for use as a blocking control in assays to test for specificity of this ESRRG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ESRRG

Target: ESRRG (Estrogen-Related Receptor gamma (ESRRG))

Alternative Name: ESRRG (ESRRG Products)

Synonyms: ERR3 antibody, ERRgamma antibody, NR3B3 antibody, ESRRG antibody, USH2A antibody, DKFZp459J0417 antibody, err3 antibody, nr3b3 antibody, LOC100219115 antibody, errg antibody, errgamma antibody, esrrg antibody, errb/g antibody, esrrgl antibody, errbeta/gamma antibody, Errg antibody, mKIAA0832 antibody, estrogen related receptor gamma antibody, estrogen-related receptor gamma antibody, estrogen-related receptor gamma a antibody, estrogen-related receptor gamma b antibody, ESRRG antibody, esrrg antibody, Esrrg antibody, esrrga antibody, esrrgb antibody

Background: ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway