RRP1B antibody

Catalog No. ABIN630542

Product Details anti-RRP1B Antibody

Target: RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RRP1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RRP1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RRP1B Blocking Peptide, catalog no. 33R-9842, is also available for use as a blocking control in assays to test for specificity of this RRP1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RRP1B

Target: RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))

Alternative Name: RRP1B (RRP1B Products)

Synonyms: 2600005C20Rik antibody, D030064A17 antibody, Kiaa0179 antibody, mKIAA0179 antibody, KIAA0179 antibody, NNP1L antibody, Nnp1 antibody, RRP1 antibody, RGD1305633 antibody, ribosomal RNA processing 1B antibody, ribosomal RNA processing 1 homolog B (S. cerevisiae) antibody, ribosomal RNA processing 1B L homeolog antibody, RRP1B antibody, Rrp1b antibody, rrp1b.L antibody

Background: RRP1B belongs to the RRP1 family. It may be a novel susceptibility gene for breast cancer progression and metastasis.

Molecular Weight: 84 kDa (MW of target protein)