NASP antibody
-
- Target See all NASP Antibodies
- NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NASP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV
- Top Product
- Discover our top product NASP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NASP Blocking Peptide, catalog no. 33R-4313, is also available for use as a blocking control in assays to test for specificity of this NASP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NASP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))
- Alternative Name
- NASP (NASP Products)
- Synonyms
- FLB7527 antibody, PRO1999 antibody, 5033430J04Rik antibody, AI131596 antibody, AI317140 antibody, D4Ertd767e antibody, Epcs32 antibody, Nasp-T antibody, wu:fd20g12 antibody, zgc:56007 antibody, zgc:85651 antibody, nuclear autoantigenic sperm protein antibody, nuclear autoantigenic sperm protein (histone-binding) antibody, NASP antibody, Nasp antibody, nasp antibody
- Background
- This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene.
- Molecular Weight
- 49 kDa (MW of target protein)
-