NASP antibody

Catalog No. ABIN630609

Product Details anti-NASP Antibody

Target: NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NASP antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NASP Blocking Peptide, catalog no. 33R-4313, is also available for use as a blocking control in assays to test for specificity of this NASP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NASP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NASP

Target: NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))

Alternative Name: NASP (NASP Products)

Synonyms: FLB7527 antibody, PRO1999 antibody, 5033430J04Rik antibody, AI131596 antibody, AI317140 antibody, D4Ertd767e antibody, Epcs32 antibody, Nasp-T antibody, wu:fd20g12 antibody, zgc:56007 antibody, zgc:85651 antibody, nuclear autoantigenic sperm protein antibody, nuclear autoantigenic sperm protein (histone-binding) antibody, NASP antibody, Nasp antibody, nasp antibody

Background: This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene.

Molecular Weight: 49 kDa (MW of target protein)