Cnpase antibody (Middle Region)
-
- Target See all Cnpase (CNP) Antibodies
- Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cnpase antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CNP antibody was raised against the middle region of CNP
- Purification
- Affinity purified
- Immunogen
- CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII
- Top Product
- Discover our top product CNP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CNP Blocking Peptide, catalog no. 33R-5574, is also available for use as a blocking control in assays to test for specificity of this CNP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))
- Alternative Name
- CNP (CNP Products)
- Synonyms
- CNP1 antibody, CNPase antibody, Cnp-1 antibody, Cnp1 antibody, CNPF antibody, CNPI antibody, CNPII antibody, CNP antibody, DKFZp469F1421 antibody, cnpl antibody, fd21d08 antibody, fi37a10 antibody, rich antibody, sb:cb662 antibody, si:ch73-158e11.4 antibody, wu:fd21d08 antibody, wu:fd44a05 antibody, wu:fi35d08 antibody, wu:fi37a10 antibody, cnp antibody, 2',3'-cyclic nucleotide 3' phosphodiesterase antibody, CNP antibody, Cnp antibody, cnp antibody, cnp.L antibody
- Background
- CNP belongs to the cyclic nucleotide phosphodiesterase family. It interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes. reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.
- Molecular Weight
- 47 kDa (MW of target protein)
-