STRADA antibody (N-Term)
-
- Target See all STRADA Antibodies
- STRADA (STE20-Related Kinase Adaptor alpha (STRADA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STRADA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LYK5 antibody was raised against the N terminal of LYK5
- Purification
- Affinity purified
- Immunogen
- LYK5 antibody was raised using the N terminal of LYK5 corresponding to a region with amino acids MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL
- Top Product
- Discover our top product STRADA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LYK5 Blocking Peptide, catalog no. 33R-6420, is also available for use as a blocking control in assays to test for specificity of this LYK5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYK5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STRADA (STE20-Related Kinase Adaptor alpha (STRADA))
- Alternative Name
- LYK5 (STRADA Products)
- Synonyms
- fj99g05 antibody, zgc:56109 antibody, wu:fj99g05 antibody, lyk5 antibody, LYK5 antibody, NY-BR-96 antibody, PMSE antibody, STRAD antibody, Stlk antibody, Lyk5 antibody, 2610019A05Rik antibody, 6030402H20Rik antibody, AI480680 antibody, E130112C09Rik antibody, STE20-related kinase adaptor alpha antibody, ste20-related kinase adaptor alpha antibody, STRADA antibody, strada antibody, Strada antibody
- Background
- LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- AMPK Signaling
-