Lamin B1 antibody (Middle Region)

Catalog No. ABIN630637

Product Details anti-Lamin B1 Antibody

Target: Lamin B1 (LMNB1)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Lamin B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Lamin B1 antibody was raised against the middle region of LMNB1

Purification: Affinity purified

Immunogen: Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lamin B1 Blocking Peptide, catalog no. 33R-2393, is also available for use as a blocking control in assays to test for specificity of this Lamin B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Lamin B1

Target: Lamin B1 (LMNB1)

Alternative Name: Lamin B1 (LMNB1 Products)

Synonyms: MGC52550 antibody, Lamin-L(I) antibody, lamin-b antibody, lmn antibody, lmn2 antibody, lmnb antibody, LMNB1 antibody, ADLD antibody, LMN antibody, LMN2 antibody, LMNB antibody, fc06g01 antibody, wu:fc06g01 antibody, lamin B1 L homeolog antibody, lamin B1 antibody, lmnb1.L antibody, lmnb1 antibody, LMNB1 antibody, Lmnb1 antibody

Background: LAMNB1 encodes for one of the two B type proteins of the nuclear lamina, B1. The Vertebrate lamins consist of two types, A and B. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: Apoptosis, Caspase Cascade in Apoptosis