CHFR antibody (N-Term)

Catalog No. ABIN630645

Product Details anti-CHFR Antibody

Target: CHFR (Checkpoint with Forkhead and Ring Finger Domains (CHFR))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHFR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHFR antibody was raised against the N terminal of CHFR

Purification: Affinity purified

Immunogen: CHFR antibody was raised using the N terminal of CHFR corresponding to a region with amino acids REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHFR Blocking Peptide, catalog no. 33R-7895, is also available for use as a blocking control in assays to test for specificity of this CHFR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHFR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHFR

Target: CHFR (Checkpoint with Forkhead and Ring Finger Domains (CHFR))

Alternative Name: CHFR (CHFR Products)

Synonyms: RNF116 antibody, RNF196 antibody, CHFR antibody, fc43f10 antibody, si:dkey-69h6.7 antibody, wu:fc43f10 antibody, rnf116 antibody, rnf196 antibody, 5730484M20Rik antibody, C230082M18 antibody, checkpoint with forkhead and ring finger domains antibody, checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase antibody, checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase L homeolog antibody, CHFR antibody, chfr antibody, Chfr antibody, chfr.L antibody

Background: CHFR is an E3 ubiquitin-protein ligase required to transiently arrest cells in early prophase when they are exposed to microtubule poisons. It acts in early prophase before chromosome condensation, when the centrosome moves apart from each other along the periphery of the nucleus. CHFR probably promotes the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress. This suggests that it may be involved in signaling the presence of mitotic stress caused by microtubule poisons.

Molecular Weight: 69 kDa (MW of target protein)