MAP3K15 antibody (Middle Region)
-
- Target See all MAP3K15 Antibodies
- MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAP3K15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAP3 K15 antibody was raised against the middle region of MAP3 15
- Purification
- Affinity purified
- Immunogen
- MAP3 K15 antibody was raised using the middle region of MAP3 15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT
- Top Product
- Discover our top product MAP3K15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAP3K15 Blocking Peptide, catalog no. 33R-9170, is also available for use as a blocking control in assays to test for specificity of this MAP3K15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))
- Alternative Name
- MAP3K15 (MAP3K15 Products)
- Synonyms
- MCO15.4 antibody, MCO15_4 antibody, mitogen-activated protein kinase kinase kinase 15 antibody, ASK3 antibody, bA723P2.3 antibody, BC031147 antibody, MEKK15 antibody, mitogen-activated protein kinase kinase kinase 15 antibody, MAPKKK15 antibody, MAP3K15 antibody, Map3k15 antibody
- Background
- MAP3K15 is a component of a protein kinase signal transduction cascade.
- Molecular Weight
- 89 kDa (MW of target protein)
-