KPNA4 antibody

Catalog No. ABIN630664

Product Details anti-KPNA4 Antibody

Target: KPNA4 (Karyopherin (Importin) alpha 4 (KPNA4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KPNA4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Karyopherin Alpha 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Karyopherin Alpha 4 Blocking Peptide, catalog no. 33R-4568, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KPNA4

Target: KPNA4 (Karyopherin (Importin) alpha 4 (KPNA4))

Alternative Name: Karyopherin alpha 4 (KPNA4 Products)

Background: The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognise NLSs and dock NLS-containing proteins to the nuclear pore complex. KPNA4 shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus