CDYL antibody (N-Term)
-
- Target See all CDYL Antibodies
- CDYL (Chromodomain Protein, Y-Like (CDYL))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDYL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CDYL antibody was raised against the n terminal of CDYL
- Purification
- Affinity purified
- Immunogen
- CDYL antibody was raised using the N terminal of CDYL corresponding to a region with amino acids YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
- Top Product
- Discover our top product CDYL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CDYL Blocking Peptide, catalog no. 33R-10137, is also available for use as a blocking control in assays to test for specificity of this CDYL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDYL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDYL (Chromodomain Protein, Y-Like (CDYL))
- Alternative Name
- CDYL (CDYL Products)
- Synonyms
- AI325931 antibody, CDYL1 antibody, chromodomain Y like antibody, chromodomain protein, Y chromosome-like antibody, chromodomain Y-like antibody, CDYL antibody, Cdyl antibody
- Background
- CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene.
- Molecular Weight
- 60 kDa (MW of target protein)
-